PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_46079_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 92aa    MW: 11354.9 Da    PI: 10.0996
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_46079_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.16.5e-113170445
                                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                      Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                                         +T++E++l+++ +k+ G + W++Ia +++ gRt++++  +w+
  cra_locus_46079_iso_2_len_362_ver_3 31 MTEQEEDLIYRMHKLVGDR-WELIAGRIP-GRTPEEIERFWL 70
                                         7****************99.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.5E-82775IPR001005SANT/Myb domain
CDDcd001673.95E-73071No hitNo description
Gene3DG3DSA:1.10.10.608.2E-123170IPR009057Homeodomain-like
PfamPF002494.0E-103171IPR001005SANT/Myb domain
SuperFamilySSF466897.41E-93272IPR009057Homeodomain-like
PROSITE profilePS500906.5513269IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MDKRRTKQRK VVRSSAYEVE VSSIEWEFIN MTEQEEDLIY RMHKLVGDRW ELIAGRIPGR  60
TPEEIERFWL MRHNDGFASR RRSEYKRRCS KY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
139RRTKQRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037890.11e-40PREDICTED: MYB-like transcription factor ETC3 isoform X2
SwissprotQ8GV051e-35TRY_ARATH; Transcription factor TRY
TrEMBLB9I8W04e-40B9I8W0_POPTR; Caprice family protein
STRINGPOPTR_0014s09200.11e-39(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117071824